PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024919m
Common NameEUTSA_v10024919mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 525aa    MW: 58413.7 Da    PI: 5.94
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024919mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.52.6e-27296349256
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      ++++Wt+eLH++Fv+aveqL G ++A+P++ilelmkv+gLt+++v+SHLQk+R++
  Thhalv10024919m 296 KKVDWTQELHKKFVQAVEQL-GVDQAIPSRILELMKVDGLTRHNVASHLQKFRMH 349
                      689*****************.********************************96 PP

2Response_reg30.91.4e-113813116109
                      HHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHH CS
     Response_reg  16 qalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeel 107
                      + le+ +y +v++++d +eal  + ++   +++ ++D++ ++ +  + +k ++++++ lp i++++    +++ +++ +Ga +fl Kp + e+l
  Thhalv10024919m  38 SKLESMDY-IVTTFTDESEALSAVLQNPegFHIAIVDVNTSTTEKEN-FKFLEAAKNVLPTIMISTDHCITTTMKCIALGAVEFLQKPLSSEKL 129
                      568999**.**************9777778************99766.588999999***********************************99 PP

                      HH CS
     Response_reg 108 vk 109
                       +
  Thhalv10024919m 130 KN 131
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011020.82519137IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.7E-736131IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.85E-1236138IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.7E-1436144No hitNo description
CDDcd001563.07E-740136No hitNo description
PROSITE profilePS5129416.771292351IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-25294351IPR009057Homeodomain-like
SuperFamilySSF466891.97E-18294352IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-25296350IPR006447Myb domain, plants
PfamPF002491.5E-7298346IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MVFTANDLSK WENFPKGLRV LLLDGGDVDG LSTAETRSKL ESMDYIVTTF TDESEALSAV  60
LQNPEGFHIA IVDVNTSTTE KENFKFLEAA KNVLPTIMIS TDHCITTTMK CIALGAVEFL  120
QKPLSSEKLK NIWQHVVHKA FNDGGTSVSE TLKPVKESVV SMLHLDTDMV TTDEKDPAPS  180
TPQLKQDSRL LDGDCHENIN SSTEKENMDD QDIGESKSVD TTNQELVVKE EKGDSEKEEG  240
EEEGESRELK EQEGETGDLK SEKTDSVDFH KKEDDTKPVN KPSGIKNLSG NKATRKKVDW  300
TQELHKKFVQ AVEQLGVDQA IPSRILELMK VDGLTRHNVA SHLQKFRMHK RNILPKEDHN  360
HRYLQNHRQI HQRQYNNGFQ QQHRPVMAYP VWGLPGVHPP GAIPPLWPPP LQSSGQLPPW  420
RWKPPYPTVN GNAWGCPVGP PVTGPFNTPP ITGTFNTPPA TQLDEEMIDQ VVKEAISKPW  480
LPLPLGLKPP SADSVLTELS RQGISAVPSS SSSSRHINGS RRIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16297348758ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414160.10.0hypothetical protein EUTSA_v10024919mg
SwissprotQ6LA430.0APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLV4MR300.0V4MR30_EUTSA; Uncharacterized protein
STRINGBra012623.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57462747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.60.0ARR-B family protein